"strconv"
"fmt"
"strings"
"internal/buildcfg"
"flag"
"fmt"
"internal/bisect"
"internal/buildcfg"
"io"
"log"
"os"
"reflect"
"sort"
"strconv"
"strings"
"internal/abi"
"strings"
"internal/buildcfg"
"os"
"path/filepath"
"runtime"
"strings"
"fmt"
"strconv"
"strings"
"sync"
"strconv"
"fmt"
"internal/abi"
"internal/buildcfg"
Auto.name
const A_AUTO = *ast.BinaryExprAuto.name
const A_DELETED_AUTOAuto.name
const A_PARAMconst ElfRelocOffset = 256const GlobalDictPrefix = ".dict"const Haixconst Hdarwinconst Hdragonflyconst Hfreebsdconst Hjsconst Hlinuxconst Hnetbsdconst Hopenbsdconst Hplan9const Hsolarisconst Hunknown HeadType = iotaconst Hwasip1const Hwindowsconst MachoRelocOffset = 2048go:generate stringer -type=RelocType
const R_ADDR RelocType = *ast.BinaryExprR_ADDRARM64 relocates an adrp, add pair to compute the address of the referenced symbol.
const R_ADDRARM64R_ADDRCUOFF resolves to a pointer-sized offset from the start of the symbol's DWARF compile unit.
const R_ADDRCUOFFR_ADDRMIPS (only used on mips/mips64) resolves to the low 16 bits of an external address, by encoding it into the instruction.
const R_ADDRMIPSR_ADDRMIPSTLS (only used on mips64) resolves to the low 16 bits of a TLS address (offset from thread pointer), by encoding it into the instruction.
const R_ADDRMIPSTLSR_ADDRMIPSU (only used on mips/mips64) resolves to the sign-adjusted "upper" 16 bits (bit 16-31) of an external address, by encoding it into the instruction.
const R_ADDRMIPSUR_ADDROFF resolves to a 32-bit offset from the beginning of the section holding the data being relocated to the referenced symbol.
const R_ADDROFFR_ADDRPOWER relocates a pair of "D-form" instructions (instructions with 16-bit immediates in the low half of the instruction word), usually addis followed by another add or a load, inserting the "high adjusted" 16 bits of the address of the referenced symbol into the immediate field of the first instruction and the low 16 bits into that of the second instruction.
const R_ADDRPOWERR_ADDRPOWER_D34 relocates a single prefixed D-form load/store operation. All prefixed forms are D form. The high 18 bits are stored in the prefix, and the low 16 are stored in the suffix. The address is absolute.
const R_ADDRPOWER_D34R_ADDRPOWER_DS is similar to R_ADDRPOWER above, but assumes the second instruction is a "DS-form" instruction, which has an immediate field occupying bits [15:2] of the instruction word. Bits [15:2] of the address of the relocated symbol are inserted into this field; it is an error if the last two bits of the address are not 0.
const R_ADDRPOWER_DSR_ADDRPOWER_GOT relocates a D-form + DS-form instruction sequence by inserting a relative displacement of referenced symbol's GOT entry to the TOC pointer.
const R_ADDRPOWER_GOTR_ADDRPOWER_GOT_PCREL34 is identical to R_ADDRPOWER_GOT, but uses a PC relative sequence to generate a GOT symbol addresses.
const R_ADDRPOWER_GOT_PCREL34R_ADDRPOWER_PCREL relocates two D-form instructions like R_ADDRPOWER, but inserts the displacement from the place being relocated to the address of the relocated symbol instead of just its address.
const R_ADDRPOWER_PCRELR_ADDRPOWER_PCREL34 relates a single prefixed D-form load/store/add operation. All prefixed forms are D form. The resulting address is relative to the PC. It is a signed 34 bit offset.
const R_ADDRPOWER_PCREL34R_ADDRPOWER_TOCREL relocates two D-form instructions like R_ADDRPOWER, but inserts the offset from the TOC to the address of the relocated symbol rather than the symbol's address.
const R_ADDRPOWER_TOCRELR_ADDRPOWER_TOCREL_DS relocates a D-form, DS-form instruction sequence like R_ADDRPOWER_DS but inserts the offset from the TOC to the address of the relocated symbol rather than the symbol's address.
const R_ADDRPOWER_TOCREL_DSR_ARM64_GOT resolves a GOT-relative instruction sequence, usually an adrp followed by another ld instruction.
const R_ARM64_GOTR_ARM64_GOTPCREL relocates an adrp, ld64 pair to compute the address of the GOT slot of the referenced symbol.
const R_ARM64_GOTPCRELR_ARM64_LDST128 sets a LD/ST immediate value to bits [11:4] of a local address.
const R_ARM64_LDST128R_ARM64_LDST16 sets a LD/ST immediate value to bits [11:1] of a local address.
const R_ARM64_LDST16R_ARM64_LDST32 sets a LD/ST immediate value to bits [11:2] of a local address.
const R_ARM64_LDST32R_ARM64_LDST64 sets a LD/ST immediate value to bits [11:3] of a local address.
const R_ARM64_LDST64R_ARM64_LDST8 sets a LD/ST immediate value to bits [11:0] of a local address.
const R_ARM64_LDST8R_ARM64_PCREL resolves a PC-relative addresses instruction sequence, usually an adrp followed by another add instruction.
const R_ARM64_PCRELR_ARM64_PCREL_LDST16 resolves a PC-relative addresses instruction sequence, usually an adrp followed by a LD16 or ST16 instruction.
const R_ARM64_PCREL_LDST16R_ARM64_PCREL_LDST32 resolves a PC-relative addresses instruction sequence, usually an adrp followed by a LD32 or ST32 instruction.
const R_ARM64_PCREL_LDST32R_ARM64_PCREL_LDST64 resolves a PC-relative addresses instruction sequence, usually an adrp followed by a LD64 or ST64 instruction.
const R_ARM64_PCREL_LDST64R_ARM64_PCREL_LDST8 resolves a PC-relative addresses instruction sequence, usually an adrp followed by a LD8 or ST8 instruction.
const R_ARM64_PCREL_LDST8Relocates an ADRP; LD64 instruction sequence to load the offset between the thread local base and the thread local variable defined by the referenced (thread local) symbol from the GOT.
const R_ARM64_TLS_IESet a MOV[NZ] immediate field to bits [15:0] of the offset from the thread local base to the thread local variable defined by the referenced (thread local) symbol. Error if the offset does not fit into 16 bits.
const R_ARM64_TLS_LEgo:generate stringer -type=RelocType
const R_CALLgo:generate stringer -type=RelocType
const R_CALLARMgo:generate stringer -type=RelocType
const R_CALLARM64go:generate stringer -type=RelocType
const R_CALLINDR_CALLLOONG64 resolves to non-PC-relative target address of a CALL (BL/JIRL) instruction, by encoding the address into the instruction.
const R_CALLLOONG64R_CALLMIPS (only used on mips64) resolves to non-PC-relative target address of a CALL (JAL) instruction, by encoding the address into the instruction.
const R_CALLMIPSgo:generate stringer -type=RelocType
const R_CALLPOWERgo:generate stringer -type=RelocType
const R_CONSTR_DWARFFILEREF resolves to an index into the DWARF .debug_line file table for the specified file symbol. Must be applied to an attribute of form DW_FORM_data4.
const R_DWARFFILEREFR_DWARFSECREF resolves to the offset of the symbol from its section. Target of relocation must be size 4 (in current implementation).
const R_DWARFSECREFgo:generate stringer -type=RelocType
const R_GOTOFFgo:generate stringer -type=RelocType
const R_GOTPCRELR_INITORDER specifies an ordering edge between two inittask records. (From one p..inittask record to another one.) This relocation does not apply any changes to the actual data, it is just used in the linker to order the inittask records appropriately.
const R_INITORDERR_JMP16LOONG64 resolves to 18-bit PC-relative target address of a JMP instructions.
const R_JMP16LOONG64R_JMP21LOONG64 resolves to 23-bit PC-relative target address of a JMP instructions.
const R_JMP21LOONG64R_JMPLOONG64 resolves to non-PC-relative target address of a JMP instruction, by encoding the address into the instruction.
const R_JMPLOONG64R_JMPMIPS (only used on mips64) resolves to non-PC-relative target address of a JMP instruction, by encoding the address into the instruction. The stack nosplit check ignores this since it is not a function call.
const R_JMPMIPSR_KEEP tells the linker to keep the referred-to symbol in the final binary if the symbol containing the R_KEEP relocation is in the final binary.
const R_KEEP64-bit in-place addition.
const R_LOONG64_ADD64R_LOONG64_ADDR_HI resolves to the sign-adjusted "upper" 20 bits (bit 5-24) of an external address, by encoding it into the instruction. R_LOONG64_ADDR_LO resolves to the low 12 bits of an external address, by encoding it into the instruction.
const R_LOONG64_ADDR_HIgo:generate stringer -type=RelocType
const R_LOONG64_ADDR_LOR_LOONG64_GOT_HI and R_LOONG64_GOT_LO resolves a GOT-relative instruction sequence, usually an pcalau12i followed by another ld or addi instruction.
const R_LOONG64_GOT_HIgo:generate stringer -type=RelocType
const R_LOONG64_GOT_LO64-bit in-place subtraction.
const R_LOONG64_SUB64R_LOONG64_TLS_IE_HI and R_LOONG64_TLS_IE_LO relocates a pcalau12i, ld.d pair to compute the address of the GOT slot of the tls symbol.
const R_LOONG64_TLS_IE_HIgo:generate stringer -type=RelocType
const R_LOONG64_TLS_IE_LOR_LOONG64_TLS_LE_HI resolves to the high 20 bits of a TLS address (offset from thread pointer), by encoding it into the instruction. R_LOONG64_TLS_LE_LO resolves to the low 12 bits of a TLS address (offset from thread pointer), by encoding it into the instruction.
const R_LOONG64_TLS_LE_HIgo:generate stringer -type=RelocType
const R_LOONG64_TLS_LE_LOR_METHODOFF resolves to a 32-bit offset from the beginning of the section holding the data being relocated to the referenced symbol. It is a variant of R_ADDROFF used when linking from the uncommonType of a *rtype, and may be set to zero by the linker if it determines the method text is unreachable by the linked program.
const R_METHODOFFgo:generate stringer -type=RelocType
const R_PCRELR_PCRELDBL relocates s390x 2-byte aligned PC-relative addresses. TODO(mundaym): remove once variants can be serialized - see issue 14218.
const R_PCRELDBLR_PEIMAGEOFF resolves to a 32-bit offset from the start address of where the executable file is mapped in memory.
const R_PEIMAGEOFFgo:generate stringer -type=RelocType
const R_PLT0go:generate stringer -type=RelocType
const R_PLT1go:generate stringer -type=RelocType
const R_PLT2R_POWER_TLS marks an X-form instruction such as "ADD R3,R13,R4" as completing a sequence of GOT-relative relocations to compute a TLS address. This can be used by the system linker to rewrite the GOT-relative TLS relocation into a simpler thread-pointer relative relocation. See table 3.26 and 3.28 in the ppc64 elfv2 1.4 ABI on this transformation. Likewise, the second argument (usually called RB in X-form instructions) is assumed to be R13.
const R_POWER_TLSR_POWER_TLS_IE is used to implement the "initial exec" model for tls access. It relocates a D-form, DS-form instruction sequence like R_ADDRPOWER_DS. It inserts to the offset of GOT slot for the thread-local symbol from the TOC (the GOT slot is filled by the dynamic linker with the offset of the thread-local symbol from the thread pointer (R13)).
const R_POWER_TLS_IER_POWER_TLS_IE_PCREL34 is similar to R_POWER_TLS_IE, but marks a single MOVD which has been assembled as a single prefixed load doubleword without using the TOC.
const R_POWER_TLS_IE_PCREL34R_POWER_TLS_LE is used to implement the "local exec" model for tls access. It resolves to the offset of the thread-local symbol from the thread pointer (R13) and is split against a pair of instructions to support a 32 bit displacement.
const R_POWER_TLS_LER_POWER_TLS_LE_TPREL34 is similar to R_POWER_TLS_LE, but computes an offset from the thread pointer in one prefixed instruction.
const R_POWER_TLS_LE_TPREL34go:generate stringer -type=RelocType
const R_POWER_TOCR_RISCV_BRANCH resolves a 12-bit PC-relative branch offset.
const R_RISCV_BRANCHR_RISCV_CALL resolves a 32 bit PC-relative address for an AUIPC + JALR instruction pair.
const R_RISCV_CALLR_RISCV_GOT_HI20 resolves the high 20 bits of a 32-bit PC-relative GOT address.
const R_RISCV_GOT_HI20R_RISCV_JAL resolves a 20 bit offset for a J-type instruction.
const R_RISCV_JALR_RISCV_JAL_TRAMP is the same as R_RISCV_JAL but denotes the use of a trampoline, which we may be able to avoid during relocation. These are only used by the linker and are not emitted by the compiler or assembler.
const R_RISCV_JAL_TRAMPR_RISCV_PCREL_HI20 resolves the high 20 bits of a 32-bit PC-relative address.
const R_RISCV_PCREL_HI20R_RISCV_PCREL_ITYPE resolves a 32 bit PC-relative address for an AUIPC + I-type instruction pair.
const R_RISCV_PCREL_ITYPER_RISCV_PCREL_LO12_I resolves the low 12 bits of a 32-bit PC-relative address using an I-type instruction.
const R_RISCV_PCREL_LO12_IR_RISCV_PCREL_LO12_S resolves the low 12 bits of a 32-bit PC-relative address using an S-type instruction.
const R_RISCV_PCREL_LO12_SR_RISCV_PCREL_STYPE resolves a 32 bit PC-relative address for an AUIPC + S-type instruction pair.
const R_RISCV_PCREL_STYPER_RISCV_RVC_BRANCH resolves an 8-bit PC-relative offset for a CB-type instruction.
const R_RISCV_RVC_BRANCHR_RISCV_RVC_JUMP resolves an 11-bit PC-relative offset for a CJ-type instruction.
const R_RISCV_RVC_JUMPR_RISCV_TLS_IE resolves a 32 bit TLS initial-exec address for an AUIPC + I-type instruction pair.
const R_RISCV_TLS_IER_RISCV_TLS_LE resolves a 32 bit TLS local-exec address for a LUI + I-type instruction sequence.
const R_RISCV_TLS_LEgo:generate stringer -type=RelocType
const R_SIZER_TLS_IE, used 386, amd64, and ARM resolves to the PC-relative offset to a GOT slot containing the offset from the thread-local symbol from the thread local base and is used to implemented the "initial exec" model for tls access (r.Sym is not set on intel platforms but is set to a TLS symbol -- runtime.tlsg -- in the linker when externally linking).
const R_TLS_IER_TLS_LE, used on 386, amd64, and ARM, resolves to the offset of the thread-local symbol from the thread local base and is used to implement the "local exec" model for tls access (r.Sym is not set on intel platforms but is set to a TLS symbol -- runtime.tlsg -- in the linker when externally linking).
const R_TLS_LEgo:generate stringer -type=RelocType
const R_USEFIELDR_USEIFACE marks a type is converted to an interface in the function this relocation is applied to. The target is a type descriptor or an itab (in the latter case it refers to the concrete type contained in the itab). This is a marker relocation (0-sized), for the linker's reachabililty analysis.
const R_USEIFACER_USEIFACEMETHOD marks an interface method that is used in the function this relocation is applied to. The target is an interface type descriptor. The addend is the offset of the method in the type descriptor. This is a marker relocation (0-sized), for the linker's reachabililty analysis.
const R_USEIFACEMETHODR_USENAMEDMETHOD marks that methods with a specific name must not be eliminated. The target is a symbol containing the name of a method called via a generic interface or looked up via MethodByName("F").
const R_USENAMEDMETHODR_USETYPE resolves to an *rtype, but no relocation is created. The linker uses this as a signal that the pointed-to type information should be linked into the final binary, even if there are no other direct references. (This is used for types reachable by reflection.)
const R_USETYPER_WASMIMPORT resolves to the index of the WebAssembly function import.
const R_WASMIMPORTR_WEAK marks the relocation as a weak reference. A weak relocation does not make the symbol it refers to reachable, and is only honored by the linker if the symbol is in some other way reachable.
const R_WEAK = *ast.BinaryExprgo:generate stringer -type=RelocType
const R_WEAKADDR = *ast.BinaryExprgo:generate stringer -type=RelocType
const R_WEAKADDROFF = *ast.BinaryExprR_XCOFFREF (only used on aix/ppc64) prevents garbage collection by ld of a symbol. This isn't a real relocation, it can be placed in anywhere in a symbol and target any symbols.
const R_XCOFFREFStatically data that is initially all 0s
const SBSSDefined SymKind values. These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind TODO(rsc): Give idiomatic Go names. go:generate stringer -type=SymKind
const SCOVERAGE_AUXVARCoverage instrumentation counter, aux variable for cmd/cover
const SCOVERAGE_COUNTERStatic data
const SDATADefined SymKind values. These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind TODO(rsc): Give idiomatic Go names. go:generate stringer -type=SymKind
const SDATAFIPSDefined SymKind values. These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind TODO(rsc): Give idiomatic Go names. go:generate stringer -type=SymKind
const SDWARFABSFCNDefined SymKind values. These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind TODO(rsc): Give idiomatic Go names. go:generate stringer -type=SymKind
const SDWARFCONSTDebugging data
const SDWARFCUINFODefined SymKind values. These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind TODO(rsc): Give idiomatic Go names. go:generate stringer -type=SymKind
const SDWARFFCNDefined SymKind values. These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind TODO(rsc): Give idiomatic Go names. go:generate stringer -type=SymKind
const SDWARFLINESDefined SymKind values. These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind TODO(rsc): Give idiomatic Go names. go:generate stringer -type=SymKind
const SDWARFLOCDefined SymKind values. These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind TODO(rsc): Give idiomatic Go names. go:generate stringer -type=SymKind
const SDWARFRANGEDefined SymKind values. These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind TODO(rsc): Give idiomatic Go names. go:generate stringer -type=SymKind
const SDWARFTYPEDefined SymKind values. These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind TODO(rsc): Give idiomatic Go names. go:generate stringer -type=SymKind
const SDWARFVARCoverage instrumentation counter for libfuzzer.
const SLIBFUZZER_8BIT_COUNTERStatically data that is initially all 0s and does not contain pointers
const SNOPTRBSSStatic data that does not contain any pointers
const SNOPTRDATADefined SymKind values. These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind TODO(rsc): Give idiomatic Go names. go:generate stringer -type=SymKind
const SNOPTRDATAFIPSRead only static data
const SRODATADefined SymKind values. These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind TODO(rsc): Give idiomatic Go names. go:generate stringer -type=SymKind
const SRODATAFIPSDefined SymKind values. These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind TODO(rsc): Give idiomatic Go names. go:generate stringer -type=SymKind
const SSEHUNWINDINFOExecutable instructions
const STEXTDefined SymKind values. These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind TODO(rsc): Give idiomatic Go names. go:generate stringer -type=SymKind
const STEXTFIPSThread-local data that is initially all 0s
const STLSBSSAn otherwise invalid zero value for the type
const Sxxx SymKind = iotavar _RelocType_index = [...]uint16{...}const _RelocType_name = "R_ADDRR_ADDRPOWERR_ADDRARM64R_ADDRMIPSR_ADDROFFR_SIZER_CALLR_CALLARMR_CALLARM64R_CALLINDR_CALLPOWERR_CALLMIPSR_CONSTR_PCRELR_TLS_LER_TLS_IER_GOTOFFR_PLT0R_PLT1R_PLT2R_USEFIELDR_USETYPER_USEIFACER_USEIFACEMETHODR_USENAMEDMETHODR_METHODOFFR_KEEPR_POWER_TOCR_GOTPCRELR_JMPMIPSR_DWARFSECREFR_DWARFFILEREFR_ARM64_TLS_LER_ARM64_TLS_IER_ARM64_GOTPCRELR_ARM64_GOTR_ARM64_PCRELR_ARM64_PCREL_LDST8R_ARM64_PCREL_LDST16R_ARM64_PCREL_LDST32R_ARM64_PCREL_LDST64R_ARM64_LDST8R_ARM64_LDST16R_ARM64_LDST32R_ARM64_LDST64R_ARM64_LDST128R_POWER_TLS_LER_POWER_TLS_IER_POWER_TLSR_POWER_TLS_IE_PCREL34R_POWER_TLS_LE_TPREL34R_ADDRPOWER_DSR_ADDRPOWER_GOTR_ADDRPOWER_GOT_PCREL34R_ADDRPOWER_PCRELR_ADDRPOWER_TOCRELR_ADDRPOWER_TOCREL_DSR_ADDRPOWER_D34R_ADDRPOWER_PCREL34R_RISCV_JALR_RISCV_JAL_TRAMPR_RISCV_CALLR_RISCV_PCREL_ITYPER_RISCV_PCREL_STYPER_RISCV_TLS_IER_RISCV_TLS_LER_RISCV_GOT_HI20R_RISCV_PCREL_HI20R_RISCV_PCREL_LO12_IR_RISCV_PCREL_LO12_SR_RISCV_BRANCHR_RISCV_RVC_BRANCHR_RISCV_RVC_JUMPR_PCRELDBLR_LOONG64_ADDR_HIR_LOONG64_ADDR_LOR_LOONG64_TLS_LE_HIR_LOONG64_TLS_LE_LOR_CALLLOONG64R_LOONG64_TLS_IE_HIR_LOONG64_TLS_IE_LOR_LOONG64_GOT_HIR_LOONG64_GOT_LOR_LOONG64_ADD64R_LOONG64_SUB64R_JMP16LOONG64R_JMP21LOONG64R_JMPLOONG64R_ADDRMIPSUR_ADDRMIPSTLSR_ADDRCUOFFR_WASMIMPORTR_XCOFFREFR_PEIMAGEOFFR_INITORDER"var _SymKind_index = [...]uint16{...}const _SymKind_name = "SxxxSTEXTSTEXTFIPSSRODATASRODATAFIPSSNOPTRDATASNOPTRDATAFIPSSDATASDATAFIPSSBSSSNOPTRBSSSTLSBSSSDWARFCUINFOSDWARFCONSTSDWARFFCNSDWARFABSFCNSDWARFTYPESDWARFVARSDWARFRANGESDWARFLOCSDWARFLINESSLIBFUZZER_8BIT_COUNTERSCOVERAGE_COUNTERSCOVERAGE_AUXVARSSEHUNWINDINFO"var allowAsmABIPkgs = []string{...}var buildID stringconst debugHelpHeader = `usage: -d arg[,arg]* and arg is [=]
is one of:
` extraNoInstrumentPkgs is the set of packages in addition to runtimePkgs that should have NoInstrument set.
var extraNoInstrumentPkgs = []string{...}var funcIDs = map[string]abi.FuncID{...}var noRaceFuncPkgs = []string{...}var pkgSpecialsOnce = *ast.CallExprvar runtimePkgs = []string{...}A DebugSSA function is called to set a -d ssa/... option. If nil, those options are reported as invalid options. If DebugSSA returns a non-empty string, that text is reported as a compiler error. If phase is "help", it should print usage information and terminate the process.
type DebugSSA func(phase string, flag string, val int, valString string) stringHeadType is the executable header type.
type HeadType uint8type RelocType int16A SymKind describes the kind of memory represented by a symbol.
type SymKind uint8count is a flag.Value that is like a flag.Bool and a flag.Int. If used as -name, it increments the count, but -name=x sets the count. Used for verbose flag -v.
type count inttype fn1 func(string)type DebugFlag struct {
tab map[string]debugField
concurrentOk *bool
debugSSA DebugSSA
}PkgSpecial indicates special build properties of a given runtime-related package.
type PkgSpecial struct {
Runtime bool
NoInstrument bool
NoRaceFunc bool
AllowAsmABI bool
}type debugField struct {
name string
help string
concurrentOk bool
val interface{}
}type versionFlag struct {
}AbsFile returns the absolute filename for file in the given directory, as rewritten by the rewrites argument. For unrewritten paths, AbsFile rewrites a leading $GOROOT prefix to the literal "$GOROOT". If the resulting path is the empty string, the result is "??". The rewrites argument is a ;-separated list of rewrites. Each rewrite is of the form "prefix" or "prefix=>replace", where prefix must match a leading sequence of path elements and is either removed entirely or replaced by the replacement.
func AbsFile(dir string, file string, rewrites string) stringfunc AddVersionFlag()ApplyRewrites returns the filename for file in the given directory, as rewritten by the rewrites argument. The rewrites argument is a ;-separated list of rewrites. Each rewrite is of the form "prefix" or "prefix=>replace", where prefix must match a leading sequence of path elements and is either removed entirely or replaced by the replacement.
func ApplyRewrites(file string, rewrites string) (string, bool)DecodeArg decodes an argument. This function is public for testing with the parallel encoder.
func DecodeArg(arg string) stringfunc Flagcount(name string, usage string, val *int)func Flagfn1(name string, usage string, f func(string))func Flagparse(usage func())func Flagprint(w io.Writer)func (versionFlag) Get() interface{}func (c *count) Get() interface{}Get the function ID for the named function in the named file. The function should be package-qualified.
func GetFuncID(name string, isWrapper bool) abi.FuncIDHeaderString returns the toolchain configuration string written in Go object headers. This string ensures we don't attempt to import or link object files that are incompatible with each other. This string always starts with "go object ".
func HeaderString() stringfunc (versionFlag) IsBoolFlag() boolfunc (c *count) IsBoolFlag() boolfunc (c *count) IsCountFlag() boolIsDATA reports whether t is one of the DATA kinds (SDATA or SDATAFIPS, excluding NOPTRDATA, RODATA, BSS, and so on).
func (t SymKind) IsDATA() boolIsDirectCall reports whether r is a relocation for a direct call. A direct call is a CALL instruction that takes the target address as an immediate. The address is embedded into the instruction(s), possibly with limited width. An indirect call is a CALL instruction that takes the target address in register or memory.
func (r RelocType) IsDirectCall() boolIsDirectCallOrJump reports whether r is a relocation for a direct call or a direct jump.
func (r RelocType) IsDirectCallOrJump() boolIsDirectJump reports whether r is a relocation for a direct jump. A direct jump is a JMP instruction that takes the target address as an immediate. The address is embedded into the instruction, possibly with limited width. An indirect jump is a JMP instruction that takes the target address in register or memory.
func (r RelocType) IsDirectJump() boolIsFIPS reports whether t is one fo the FIPS kinds.
func (t SymKind) IsFIPS() boolIsText reports whether t is one of the text kinds.
func (t SymKind) IsText() boolLookupPkgSpecial returns special build properties for the given package path.
func LookupPkgSpecial(pkgPath string) PkgSpecialNewDebugFlag constructs a DebugFlag for the fields of debug, which must be a pointer to a struct. Each field of *debug is a different value, named for the lower-case of the field name. Each field must be an int or string and must have a `help` struct tag. There may be an "Any bool" field, which will be set if any debug flags are set. The returned flag takes a comma-separated list of settings. Each setting is name=value; for ints, name is short for name=1. If debugSSA is non-nil, any debug flags of the form ssa/... will be passed to debugSSA for processing.
func NewDebugFlag(debug interface{}, debugSSA DebugSSA) *DebugFlagPathToPrefix converts raw string to the prefix that will be used in the symbol table. All control characters, space, '%' and '"', as well as non-7-bit clean bytes turn into %xx. The period needs escaping only in the last segment of the path, and it makes for happier users if we escape that as little as possible.
func PathToPrefix(s string) stringPrefixToPath is the inverse of PathToPrefix, replacing escape sequences with the original character.
func PrefixToPath(s string) (string, error)func (f *DebugFlag) Set(debugstr string) errorfunc (f fn1) Set(s string) errorfunc (h *HeadType) Set(s string) errorfunc (versionFlag) Set(s string) errorfunc (c *count) Set(s string) errorfunc StackNosplit(race bool) intfunc (c *count) String() stringfunc (f fn1) String() stringfunc (i RelocType) String() stringfunc (h HeadType) String() stringfunc (f *DebugFlag) String() stringfunc (i SymKind) String() stringfunc (versionFlag) String() stringWorkingDir returns the current working directory (or "/???" if the directory cannot be identified), with "/" as separator.
func WorkingDir() stringfunc _()func _()applyRewrite applies the rewrite to the path, returning the rewritten path and a boolean indicating whether the rewrite applied at all.
func applyRewrite(path string, rewrite string) (string, bool)expandArgs expands "response files" arguments in the provided slice. A "response file" argument starts with '@' and the rest of that argument is a filename with CR-or-CRLF-separated arguments. Each argument in the named files can also contain response file arguments. See Issue 18468. The returned slice 'out' aliases 'in' iff the input did not contain any response file arguments. TODO: handle relative paths of recursive expansions in different directories? Is there a spec for this? Are relative paths allowed?
func expandArgs(in []string) (out []string)Does s have t as a path prefix? That is, does s == t or does s begin with t followed by a slash? For portability, we allow ASCII case folding, so that hasPathPrefix("a/b/c", "A/B") is true. Similarly, we allow slash folding, so that hasPathPrefix("a/b/c", "a\\b") is true. We do not allow full Unicode case folding, for fear of causing more confusion or harm than good. (For an example of the kinds of things that can go wrong, see http://article.gmane.org/gmane.linux.kernel/1853266.)
func hasPathPrefix(s string, t string) boolstackGuardMultiplier returns a multiplier to apply to the default stack guard size. Larger multipliers are used for non-optimized builds that have larger stack frames or for specific targets.
func stackGuardMultiplier(race bool) intGenerated with Arrow